PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G129000.1.p
Common NameSb03g010970, SORBIDRAFT_03g010970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 283aa    MW: 30154.6 Da    PI: 10.2875
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G129000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65e-174287147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                          rg W + Ed +l+d+v+q+G+ +W++Ia+++  gR++k+c++rw++ 
  Sobic.003G129000.1.p 42 RGHWRPAEDAKLKDLVAQYGPQNWNLIANKLH-GRSGKSCRLRWFNQ 87
                          899*****************************.***********996 PP

2Myb_DNA-binding58.21.9e-1894138147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ +
  Sobic.003G129000.1.p  94 RRPFSEEEEERLLAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHVL 138
                           679*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9583788IPR017930Myb domain
SuperFamilySSF466893.44E-2940135IPR009057Homeodomain-like
SMARTSM007171.2E-134190IPR001005SANT/Myb domain
PfamPF002497.7E-164287IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-264395IPR009057Homeodomain-like
CDDcd001672.23E-134586No hitNo description
PROSITE profilePS5129427.94189143IPR017930Myb domain
SMARTSM007173.6E-1693141IPR001005SANT/Myb domain
PfamPF002492.2E-1594138IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2196142IPR009057Homeodomain-like
CDDcd001675.21E-8105139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MAHEMACFLG PAPPVPALSP FHEGQAESHG HGHGSSRSGH SRGHWRPAED AKLKDLVAQY  60
GPQNWNLIAN KLHGRSGKSC RLRWFNQLDP RLNRRPFSEE EEERLLAAHR AYGNKWALIA  120
RLFPGRTDNA VKNHWHVLMA RKQREHLSGS GGGAPRRRKP SSSSSASSSS SSSAVDVVVR  180
HQHASSPLPF REAAAGAVTT RARAYSDDGE SDESVSVSTS GATDLSLGSV SGTTCLLGSL  240
PLPHCVLGSS VPSPARHRAA ASDDGRGKLA LPFFDFLGVG AT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-32421427107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154158PRRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9643191e-128EU964319.1 Zea mays clone 277929 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457639.10.0hypothetical protein SORBIDRAFT_03g010970
TrEMBLC5XH770.0C5XH77_SORBI; Putative uncharacterized protein Sb03g010970
STRINGSb03g010970.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.19e-58myb domain protein 56